Product Name :
Recombinant Rhesus Eotaxin/CCL11
Description :
FAQ COA 已发表文献 Eotaxin is a CC chemokine that signals through the CCR3 receptor. It is produced by IFN–stimulated endothelial cells and TNF-activated monocytes. Eotaxin selectively chemoattracts eosinophils and, along with Eotaxin-2 and Eotaxin-3, plays a key role in the regulation of eosinophil recruitment in the asthmatic lung and in allergic reactions. Product Properties Synonyms Small-inducible Cytokine A11 Accession P97545 GeneID 29397 Source E.coli-derived Rhesus Macaque Eotaxinprotein,His24-Pro97. Molecular Weight Approximately 8.4kDa. AA Sequence HPGSIPTSCCFTMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTKLGKEICADPKKKWVQDATKHLDQKLQ TPKP Tag None Physical Appearance Sterile Filtered White lyophilized (freeze-dried) powder. Purity > 96% by SDS-PAGE and HPLC analyses. Biological Activity Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using purified eosinophils is in a concentration range of 0.1-1.0 g/mL. Endotoxin Formulation Lyophilized from a 0.2 m filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl. Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20C. Further dilutions should be made in appropriate buffered solutions.
Storage :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
ADAM15 ProteinFormulation
GAS6 ProteinBiological Activity
Popular categories:
XCL2
GP-IX/CD42a
