Share this post on:

Name :
C19orf55 (Human) Recombinant Protein (P01)

Biological Activity :
Human C19orf55 full-length ORF (1 a.a. – 109 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=148137

Amino Acid Sequence :
MWASPAPTLIDSGDSVVAKYINRFRQAQPTSREERQPAGPTPADFWWLQSDSPGPSSQSAAAGANKPEGRPHTAVPTAVNVTSASHAVAPLQEIKQVTSPFTPSLGCLN

Molecular Weight :
37.9

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,

Gene Name :
C19orf55

Gene Alias :
DKFZp434C2231, FLJ30657, MGC131952

Gene Description :
chromosome 19 open reading frame 55

Gene Summary :

Other Designations :
hypothetical protein LOC148137

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Carbonic Anhydrase 9 (CA IX) medchemexpress
IL-7 Recombinant Proteins
Popular categories:
ICAM-1/CD54
Vitamin D Receptor

Share this post on:

Author: email exporter