Name :
LGALS9 (Human) Recombinant Protein
Biological Activity :
Human LGALS9 (NP_033665, 1 a.a. – 148 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Tag :
Protein Accession No. :
NP_033665
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=3965
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQ
Molecular Weight :
18.5
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Conventional Chromatography
Quality Control Testing :
Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer :
In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (20% glycerol).
Applications :
SDS-PAGE，
Gene Name :
LGALS9
Gene Alias :
HUAT, LGALS9A, MGC117375, MGC125973, MGC125974
Gene Description :
lectin, galactoside-binding, soluble, 9
Gene Summary :
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin’s disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq
Other Designations :
ecalectin|galectin 9|galectin-9|urate transporter/channel protein
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CNTF ProteinGene ID
IL-3 ProteinPurity & Documentation
Popular categories:
REV-ERB
CCL27
