Name :
Tnfsf11 (Mouse) Recombinant Protein
Biological Activity :
Mouse Tnfsf11 (O35235) recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
O35235
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=21943
Amino Acid Sequence :
MPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
Molecular Weight :
19.9
Storage and Stability :
Store at -20°C on dry atmosphere.After reconstitution with sterilized water, store at -20°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue Lane 1: non-reducing conditionsLane 2: reducing conditions
Storage Buffer :
Lyophilized with 10 mM Na2PO4, 50 mM NaCl, pH 7.5.
Applications :
Functional Study， SDS-PAGE，
Gene Name :
Tnfsf11
Gene Alias :
Ly109l, ODF, OPG, OPGL, RANKL, Trance
Gene Description :
tumor necrosis factor (ligand) superfamily, member 11
Gene Summary :
O
Other Designations :
OPG ligand|osteoclast differentiation factor|osteoprotegerin ligand|receptor activator of NF-kappaB ligand|tumor necrosis factor-related activation-induced cytokine
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-22 ProteinFormulation
IP-10/CXCL10 ProteinPurity & Documentation
Popular categories:
Protease Nexin I
Axl Proteins
