Name :
Tnfsf10 (Mouse) Recombinant Protein
Biological Activity :
Mouse Tnfsf10 (P50592) recombinant protein expressed in E. Coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
P50592
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=22035
Amino Acid Sequence :
MRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN
Molecular Weight :
19
Storage and Stability :
Stored at -20°C to-80°C.After reconstitution with sterile water not less than 0.1 mg/mL, store at -20°C to -80°C for 6 months, store at 4°C for 1 month.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Purification :
Quality Control Testing :
Storage Buffer :
Lyophilized from PBS, pH 7.2.
Applications :
Western Blot， Functional Study，
Gene Name :
Tnfsf10
Gene Alias :
A330042I21Rik, AI448571, APO-2L, Ly81, TL2, Trail
Gene Description :
tumor necrosis factor (ligand) superfamily, member 10
Gene Summary :
O
Other Designations :
TNF-related apoptosis inducing ligand|TRAIL/APO2L
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Cathepsin A Proteinmanufacturer
Angiotensin-Converting Enzyme 2 (ACE2) MedChemExpress
Popular categories:
Steroidogenic Factor 1
Persephin
