Name :
Il12 (Mouse) Recombinant Protein
Biological Activity :
Mouse Il12 (P43431, 23 a.a. – 215 a.a., P43432, 23 a.a. – 335 a.a.) partial recombinant protein with Il12a His tag at C-terminus expressed in Sf9 cells.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
P43431|P43432
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=16159
Amino Acid Sequence :
RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRV_x005f
_x005f
VTINRVMGYLSSAHHHHHHMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEE_x005f
_x005f
TLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
Molecular Weight :
58.3
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
insect
Interspecies Antigen Sequence :
Preparation Method :
Sf9 cell expression system
Purification :
Quality Control Testing :
Storage Buffer :
In PBS pH 7.4 (10% glycerol)
Applications :
Functional Study， SDS-PAGE，
Gene Name :
Il12a
Gene Alias :
IL-12p35, IL-12a, Ll12a, MGC151228, MGC151232, p35
Gene Description :
interleukin 12a
Gene Summary :
Other Designations :
interleukin 12a p35 subunit
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
SCF ProteinMedChemExpress
IL-23 Recombinant Proteins
Popular categories:
INSR/CD220
IL-6R
