Share this post on:

Name :
Fgf17 (Mouse) Recombinant Protein

Biological Activity :
Mouse Fgf17 recombinant protein expressed in?Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins

Tag :

Protein Accession No. :
Q0VF19

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=14171

Amino Acid Sequence :
TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQSQT

Molecular Weight :
22.5

Storage and Stability :
Lyophilized protein at room temperature for 3 weeks, should be stored at -20°C. Protein aliquots at 4°C for 2-7 days and should be stored at -20°C to -80°C. Avoid repeated freeze/thaw cycles.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :
chromatography

Quality Control Testing :

Storage Buffer :
Lyophilized from 20 mM Tris-HCl buffer(pH 8.0) cantaining?0.02% Tween-20 and 700 mM NaCl. Reconstitute the lyophilized powder in PBS to 100 ug/mL.

Applications :
Functional Study,

Gene Name :
Fgf17

Gene Alias :

Gene Description :
fibroblast growth factor 17

Gene Summary :

Other Designations :

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Cathepsin D Proteinmanufacturer
CX3CL1 Recombinant Proteins
Popular categories:
CLM-7/CD300b
CXCR3

Share this post on:

Author: email exporter