Name :
CD93 (Human) Recombinant Protein
Biological Activity :
Human CD93 partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.
Tag :
Protein Accession No. :
Q9NPY3
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=22918
Amino Acid Sequence :
TGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKVEHHHHHH
Molecular Weight :
59.3
Storage and Stability :
Store at 4°C for one weeks and should be stored at -20°C to -80°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze/thaw cycles.
Host :
Viruses
Interspecies Antigen Sequence :
Preparation Method :
Baculovirus expression system
Purification :
chromatographic
Quality Control Testing :
Storage Buffer :
Solution (0.5 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol.
Applications :
SDS-PAGE，
Gene Name :
CD93
Gene Alias :
C1qR1, C1qR(P), C1qRP, CDw93, MXRA4, dJ737E23.1
Gene Description :
CD93 molecule
Gene Summary :
The protein encoded by this gene is a cell-surface glycoprotein and type I membrane protein that was originally identified as a myeloid cell-specific marker. The encoded protein was once thought to be a receptor for C1q, but now is thought to instead be involved in intercellular adhesion and in the clearance of apoptotic cells. The intracellular cytoplasmic tail of this protein has been found to interact with moesin, a protein known to play a role in linking transmembrane proteins to the cytoskeleton and in the remodelling of the cytoskeleton. [provided by RefSeq
Other Designations :
C1q receptor 1|CD93 antigen|OTTHUMP00000030419|complement component 1, q subcomponent, receptor 1|matrix-remodelling associated 4
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
GM-CSF Proteincustom synthesis
Integrin-associated protein/CD47 ProteinPurity & Documentation
Popular categories:
Integrin Associated Protein/CD47
CD100/Semaphorin-4D
